Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tetraspanin-6 (TSPAN6)

This Recombinant Human Tetraspanin-6 (TSPAN6) spans the amino acid sequence from region 1-245.

Product Specifications

Product Name Alternative

Tetraspanin-6, Tspan-6, A15 homolog, Putative NF-kappa-B-activating protein 321, T245 protein, Tetraspanin TM4-D, Transmembrane 4 superfamily member 6

UniProt

O43657

Expression Region

1-245

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASPSRRLQTKPVITCFKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNV PFVLIATGTVIILLGTFGCFATCRASAWMLKLYAMFLTLVFLVELVAAIVGFVFRHEIKN SFKNNYEKALKQYNSTGDYRSHAVDKIQNTLHCCGVTDYRDWTDTNYYSEKGFPKSCCKL EDCTPQRDADKVNNEGCFIKVMTIIESEMGVVAGISFGVACFQLIGIFLAYCLSRAITNN QYEIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nop9 Mouse qPCR Primer Pair (NM_026403)
MP213565 200 Reactions

Nop9 Mouse qPCR Primer Pair (NM_026403)

Sign In for Pricing
View Details
1-Isoquinolin-1-ylmethanamine dihydrochloride ≥95% (NMR)
228811-01 100 mg

1-Isoquinolin-1-ylmethanamine dihydrochloride ≥95% (NMR)

Sign In for Pricing
View Details
1-Isoquinolin-1-ylmethanamine dihydrochloride ≥95% (NMR)
228811-02 250 mg

1-Isoquinolin-1-ylmethanamine dihydrochloride ≥95% (NMR)

Sign In for Pricing
View Details
1-Isoquinolin-1-ylmethanamine dihydrochloride ≥95% (NMR)
228811-03 1 g

1-Isoquinolin-1-ylmethanamine dihydrochloride ≥95% (NMR)

Sign In for Pricing
View Details
1-Isoquinolin-1-ylmethanamine dihydrochloride ≥95% (NMR)
228811-04 5 g

1-Isoquinolin-1-ylmethanamine dihydrochloride ≥95% (NMR)

Sign In for Pricing
View Details
PR3 IgG (C-ANCA) Capture ELISA
30112111 96 Determinations

PR3 IgG (C-ANCA) Capture ELISA

Sign In for Pricing
View Details