Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-6 (Tspan6)

This Recombinant Mouse Tetraspanin-6 (Tspan6) spans the amino acid sequence from region 1-245.

Product Specifications

Product Name Alternative

Tetraspanin-6, Tspan-6, Transmembrane 4 superfamily member 6

UniProt

O70401

Expression Region

1-245

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASPSRRLQTKPVITCLKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNV PFVLIGTGTVIILLGTFGCFATCRTSAWMLKLYAMFLTLIFLVELVAAIVGFVFRHEIKN SFKSNYENALKEYNSTGDYRSEAVDKIQSTLHCCGVTNYGDWKGTNYYSETGFPKSCCKL EGCYPQRDADKVNEEGCFIKVMTTIESEMGVVAGISFGVACFQLIGIFLAYCLSRAITNN QYEIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf104 (RUSC1-AS1) (NM_001039517) Human Over-expression Lysate
LY422064 100 µg

C1orf104 (RUSC1-AS1) (NM_001039517) Human Over-expression Lysate

Sign In for Pricing
View Details
Plasma/Serum Cell-Free Circulating DNA Purification Mini Kit
55100 50 Preparations

Plasma/Serum Cell-Free Circulating DNA Purification Mini Kit

Sign In for Pricing
View Details
Recombinant NRG3 Antibody
RC-5021-01 50 μL

Recombinant NRG3 Antibody

Sign In for Pricing
View Details
Recombinant NRG3 Antibody
RC-5021-02 100 µL

Recombinant NRG3 Antibody

Sign In for Pricing
View Details
Recombinant NRG3 Antibody
RC-5021-03 1 mL

Recombinant NRG3 Antibody

Sign In for Pricing
View Details
Recombinant Trk B Monoclonal Antibody
E-AB-81617-01 50 µL

Recombinant Trk B Monoclonal Antibody

Sign In for Pricing
View Details