Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-6 (Tspan6)

This Recombinant Mouse Tetraspanin-6 (Tspan6) spans the amino acid sequence from region 1-245.

Product Specifications

Product Name Alternative

Tetraspanin-6, Tspan-6, Transmembrane 4 superfamily member 6

UniProt

O70401

Expression Region

1-245

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASPSRRLQTKPVITCLKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNV PFVLIGTGTVIILLGTFGCFATCRTSAWMLKLYAMFLTLIFLVELVAAIVGFVFRHEIKN SFKSNYENALKEYNSTGDYRSEAVDKIQSTLHCCGVTNYGDWKGTNYYSETGFPKSCCKL EGCYPQRDADKVNEEGCFIKVMTTIESEMGVVAGISFGVACFQLIGIFLAYCLSRAITNN QYEIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KCNG2 activation kit by CRISPRa
GA108818 1 Kit

Human KCNG2 activation kit by CRISPRa

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (C2), CF594 conjugate, 0.1mg/mL
BNC940523-500 1x 500 µL

AFP (Alpha Fetoprotein) (C2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Neural tissue
CS709201 5x 5 µm

Tissue FFPE Sections, Neural tissue

Sign In for Pricing
View Details
SMAD3 (NM_005902) Human Over-expression Lysate
LC401784 20 µg

SMAD3 (NM_005902) Human Over-expression Lysate

Sign In for Pricing
View Details
D-(+)-Trehalose Dihydrate
TRC-T718750-5G 5 g

D-(+)-Trehalose Dihydrate

Sign In for Pricing
View Details
5-Bromo-2-chlorobenzoyl Chloride
TRC-B680522-250MG 250 mg

5-Bromo-2-chlorobenzoyl Chloride

Sign In for Pricing
View Details