Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-2, Human (HEK293)

TIMP-2 protein is a tissue inhibitor of metalloproteinases that can bind and inactivate various metalloproteinases, including collagenases, such as MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9 , MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19. It interacts with MMP2 through its C-terminal region, specifically targets the C-terminal PEX domain and inhibits MMP2 activity. TIMP-2 Protein, Human (HEK293) is the recombinant human-derived TIMP-2 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

TIMP-2 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-2-protein-human-hek293.html

Purity

96.90

Smiles

CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Molecular Formula

7077 (Gene_ID) P16035 (C27-P220) (Accession)

Molecular Weight

Approximately 20 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc1a6 Mouse Gene Knockout Kit (CRISPR)
KN515917 1 Kit

Slc1a6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DNAJB6 Antibody
KC-1101-01 50 μL

DNAJB6 Antibody

Sign In for Pricing
View Details
DNAJB6 Antibody
KC-1101-02 100 µL

DNAJB6 Antibody

Sign In for Pricing
View Details
DNAJB6 Antibody
KC-1101-03 1 mL

DNAJB6 Antibody

Sign In for Pricing
View Details
UTF1 (NM_003577) Human Over-expression Lysate
LY401188 100 µg

UTF1 (NM_003577) Human Over-expression Lysate

Sign In for Pricing
View Details
AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2491), CF594 conjugate, 0.1mg/mL
BNC942491-500 1x 500 µL

AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2491), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details