Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-2, Human (HEK293)

TIMP-2 protein is a tissue inhibitor of metalloproteinases that can bind and inactivate various metalloproteinases, including collagenases, such as MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9 , MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19. It interacts with MMP2 through its C-terminal region, specifically targets the C-terminal PEX domain and inhibits MMP2 activity. TIMP-2 Protein, Human (HEK293) is the recombinant human-derived TIMP-2 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

TIMP-2 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-2-protein-human-hek293.html

Purity

96.90

Smiles

CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Molecular Formula

7077 (Gene_ID) P16035 (C27-P220) (Accession)

Molecular Weight

Approximately 20 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLL1 Protein, Rat, Recombinant (hFc Tag)
E45R53787M4-100 100 µg

DLL1 Protein, Rat, Recombinant (hFc Tag)

Sign In for Pricing
View Details
BLK Blocking Peptide
33R-1621 100 ug

BLK Blocking Peptide

Sign In for Pricing
View Details
ZPR1 discontinued
396344 200 µL

ZPR1 discontinued

Sign In for Pricing
View Details
Irak2 Antibody Blocking peptide
orb1455132 500 µg

Irak2 Antibody Blocking peptide

Sign In for Pricing
View Details
DUSP9 Protein Vector (Human) (pPM-C-HA)
18695021 500 ng

DUSP9 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Magic™ mPro Human 5-HT1A Cell Line
S01YF-1122-KX1 1 Vial

Magic™ mPro Human 5-HT1A Cell Line

Sign In for Pricing
View Details