Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable cardiolipin synthase 1 (crls-1)

This Recombinant Probable cardiolipin synthase 1 (crls-1) spans the amino acid sequence from region 1-246.

Product Specifications

Product Name Alternative

Probable cardiolipin synthase 1, CLS, EC= 2.7.8.-

UniProt

O01916

Expression Region

1-246

Origin

Caenorhabditis elegans

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIVTSMFRGIACRCELQLLLTPRRMLRNFSSLEQKQSPKIESLPPEERGKYKVATIPNAI CTARIAATPLIGYLVVQHNFTPAFVLFTVAGATDLLDGFIARNVPGQKSLLGSVLDPVAD KLLISTMFITMTYAGLIPLPLTSVVILRDICLIGGGFYKRYQVMSPPYSLSRFFNPQVSS MQVVPTMMSKINTVLQITLVALSLSSPVFDFSTGANDVIVGLGCITGFTTIYSGLQYASG KAIKKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL
BNC680257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF640R conjugate, 0.1mg/mL
BNC400177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL
BNC470003-100 1x 100 µL

CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL
BNC801037-100 1x 100 µL

CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL
BNC042848-500 1x 500 µL

Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (B-Cell Marker) (IGKC/1999R), CF740 conjugate, 0.1mg/mL
BNC741999-500 1x 500 µL

Human Kappa Light Chain (B-Cell Marker) (IGKC/1999R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details