Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0749 (MJ0749)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0749 (MJ0749) spans the amino acid sequence from region 1-246.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0749

UniProt

Q58159

Expression Region

1-246

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSRVYIIKFDNWGFMVNLMNKIQILRKISQTLFFVRALIVTGFYLSIVGFIKRFIIGDR ILATIITKIIAIVLAFIAGRVFCGWMCPFGFLFNLVYELRVKLFKLKKLPTVDEKIHNKL IYFKYVVLILVVLAYLSGVKISGYTLAYLLLALFLVLGFIYPMFFCRYVCPVGSLLSIFA RFSIFKLKLDENKCVGCRLCERKCPMQIKITEKIDQMECIRCFECMSVCKKGALSFSAFT KNTKKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGFR (GFR1195 + 31G7), CF594 conjugate, 0.1mg/mL
BNC941200-100 1x 100 µL

EGFR (GFR1195 + 31G7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS711331 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS626363 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
CD86 (BU63), 0.2mg/mL
BNUB0193-500 1x 500 µL

CD86 (BU63), 0.2mg/mL

Sign In for Pricing
View Details
Tissue Genomic DNA, Lung
CD564686 5 µg

Tissue Genomic DNA, Lung

Sign In for Pricing
View Details
Ovary specific acidic protein (MGARP) Mouse Monoclonal Antibody [Clone ID: OTI3D9]
CF811799 100 µg

Ovary specific acidic protein (MGARP) Mouse Monoclonal Antibody [Clone ID: OTI3D9]

Sign In for Pricing
View Details