Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oryza sativa subsp. japonica Vacuolar iron transporter 1.2 (VIT1.2)

This Recombinant Oryza sativa subsp. japonica Vacuolar iron transporter 1.2 (VIT1.2) spans the amino acid sequence from region 1-246.

Product Specifications

Product Name Alternative

Vacuolar iron transporter 1.2, OsVIT1.2

UniProt

Q6ERE5

Expression Region

1-246

Origin

Oryza sativa subsp. japonica (Rice)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVKEFVQDEEKQRLLLDEHTEKHFTAGEVVRDIIIGVSDGLTVPFALAAGLSGANAPSAL VLTAGLAEVAAGAISMGLGGYLAAKSDADHYHRELQREQEEIDTVPDTEAAEIADILSQY GLGPEEYGPVVNSLRSNPKAWLEFMMKFELGLEKPEPRRALMSAGTIALAYVVGGLVPLL PYMFVPTADRAMATSVVVTLAALLFFGYVKGRFTGNRPFISAFQTAVIGALASAAAFGMA KAVQSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL
BNC470437-100 1x 100 µL

CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL
BNC470391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL
BNC470178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/468 + C8/144B), CF740 conjugate, 0.1mg/mL
BNC740750-100 1x 100 µL

CD8 (C8/468 + C8/144B), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (QBEnd/10), CF405S conjugate, 0.1mg/mL
BNC040640-100 1x 100 µL

CD34 (QBEnd/10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-9E3), CF640R conjugate, 0.1mg/mL
BNC400010-100 1x 100 µL

MART-1 / Melan-A (M2-9E3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details