Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida glabrata pH-response regulator protein palI/RIM9 (RIM9)

This Recombinant Candida glabrata pH-response regulator protein palI/RIM9 (RIM9) spans the amino acid sequence from region 1-246.

Product Specifications

Product Name Alternative

PH-response regulator protein palI/RIM9

UniProt

Q6FU42

Expression Region

1-246

Origin

Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHLFDLRTLLAILVSICVVFQAFPLATVPLNKNLILGQYMGYHFGVFGWCFVDKGVTIAC HCKFRPDSIETYKYTDQLLFPSLYKVTISTLLVVHPVSFAFTCILWIMALIIRLSRFGRC PIFILSAATWSLAAFLLALLSALVDLLLFVNKLKWPGWLVLASVPLMAICCSWLWSLRRQ VSAIFYERKAYATQTYSRFDSMELSHIDTKFSDDQSIYETYTLERVPYSKNEAIEEPALT YYTSSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405S conjugate, 0.1mg/mL
BNC041429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL
BNC680017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PTH / Parathyroid Hormone (N-Terminal) (PTH/1173), CF647 conjugate, 0.1mg/mL
BNC471173-100 1x 100 µL

PTH / Parathyroid Hormone (N-Terminal) (PTH/1173), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1a / HTA1 (Mature Langerhans Cells Marker) (rC1A/711), CF568 conjugate, 0.1mg/mL
BNC681888-100 1x 100 µL

CD1a / HTA1 (Mature Langerhans Cells Marker) (rC1A/711), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), 0.2mg/mL
BNUB0050-500 1x 500 µL

IgA Secretory Component (SC05), 0.2mg/mL

Sign In for Pricing
View Details
CD1a / HTA1 (Mature Langerhans Cells Marker) (rC1A/711), CF594 conjugate, 0.1mg/mL
BNC941888-100 1x 100 µL

CD1a / HTA1 (Mature Langerhans Cells Marker) (rC1A/711), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details