Recombinant Spinacia oleracea ATP synthase subunit a, chloroplastic (atpI)
This Recombinant Spinacia oleracea ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-247.
Product Specifications
Product Name Alternative
ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV
UniProt
P06451
Expression Region
1-247
Origin
Spinacia oleracea (Spinach)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNVLSYSINPLKGLYAISGVEVGQHFYWQIGGFQIHGQVLITSWVVIAILLGSAAIAVRS PQTIPTGGQNFFEYVLEFIRDVSKTQIGEEYRPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESLEGHH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6371469-01 0.1 mL
CELF4 (BRUNOL4, CUGBP Elav-like Family Member 4, CELF-4, Bruno-like Protein 4, CUG-BP-and ETR-3-like Factor 4, RNA-binding Protein BRUNOL-4) (MaxLight 405)
Sign In for Pricing
View Details MBS6371469-02 5x 0.1 mL
CELF4 (BRUNOL4, CUGBP Elav-like Family Member 4, CELF-4, Bruno-like Protein 4, CUG-BP-and ETR-3-like Factor 4, RNA-binding Protein BRUNOL-4) (MaxLight 405)
Sign In for Pricing
View Details 
RC200312L3V 200 µL
INSIG1 (NM_005542) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details