Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Agrostis stolonifera ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Agrostis stolonifera ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

A1EA02

Expression Region

1-247

Origin

Agrostis stolonifera (Creeping bentgrass)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNIIPCSIKTLKGLYDISGVEVGQHFYWQIGGFQIHAQVLITSWVVITILLGSVVIAVRN PQTIPTDGQNFFEYVLEFIRDLSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII ELPHGELAAPTNDINTTVALALLTSAAYFYAGLSKKGLSYFEKYIKPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZBTB10, CT (ZBTB10, RINZF, RINZFC, Zinc finger and BTB domain-containing protein 10, Zinc finger protein RIN ZF) (MaxLight 750)
MBS6364532-01 0.1 mL

ZBTB10, CT (ZBTB10, RINZF, RINZFC, Zinc finger and BTB domain-containing protein 10, Zinc finger protein RIN ZF) (MaxLight 750)

Sign In for Pricing
View Details
ZBTB10, CT (ZBTB10, RINZF, RINZFC, Zinc finger and BTB domain-containing protein 10, Zinc finger protein RIN ZF) (MaxLight 750)
MBS6364532-02 5x 0.1 mL

ZBTB10, CT (ZBTB10, RINZF, RINZFC, Zinc finger and BTB domain-containing protein 10, Zinc finger protein RIN ZF) (MaxLight 750)

Sign In for Pricing
View Details
IQCE (NM_001100390) Human Over-expression Lysate
LC420242 20 µg

IQCE (NM_001100390) Human Over-expression Lysate

Sign In for Pricing
View Details
LOC606294 Protein Vector (Rat) (pPM-C-His)
PV279001 500 ng

LOC606294 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
BCMO1 Protein Lysate (Mouse) with C-HA Tag
13250034 100 µg

BCMO1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
TRPM6 Rabbit Polyclonal Antibody
E10G05455 100 µL

TRPM6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details