Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Agrostis stolonifera ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Agrostis stolonifera ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

A1EA02

Expression Region

1-247

Origin

Agrostis stolonifera (Creeping bentgrass)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNIIPCSIKTLKGLYDISGVEVGQHFYWQIGGFQIHAQVLITSWVVITILLGSVVIAVRN PQTIPTDGQNFFEYVLEFIRDLSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII ELPHGELAAPTNDINTTVALALLTSAAYFYAGLSKKGLSYFEKYIKPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nori® Canine HSP60 ELISA Kit
GR115057 96 Well

Nori® Canine HSP60 ELISA Kit

Sign In for Pricing
View Details
ExoPure? 1.0 micron Immunobeads (Overall Exosome Isolation, plasma, urine, serum, 20 reactions)
M1039-20 each

ExoPure? 1.0 micron Immunobeads (Overall Exosome Isolation, plasma, urine, serum, 20 reactions)

Sign In for Pricing
View Details
CD20 monoclonal antibody
orb1677286-01 50 µL

CD20 monoclonal antibody

Sign In for Pricing
View Details
CD20 monoclonal antibody
orb1677286-02 100 µL

CD20 monoclonal antibody

Sign In for Pricing
View Details
CD20 monoclonal antibody
orb1677286-03 200 µL

CD20 monoclonal antibody

Sign In for Pricing
View Details
Anti-Drosophila melanogaster (Fruit fly) NCC69 Antibody FITC Conjugated
DZ41897-FITC 200 µL/Vial

Anti-Drosophila melanogaster (Fruit fly) NCC69 Antibody FITC Conjugated

Sign In for Pricing
View Details