Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Populus trichocarpa ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Populus trichocarpa ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

A4GYP6

Expression Region

1-247

Origin

Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVLSYSINTLKGLYEISGVEVGQHFYWKIGGFQVHAQVLITSWVVIVILLGSAIVTVRN PQTIPTDGQNFFEYILEFIRDVSKTQIGEEYGPWVPFIGTLFLFIFVSNWSGALLPWKII ELPHGELAAPTNDINTTVALALLTSIAYFYAGLSKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Amino-6-methylamino-d3-quinoline
A1378-59 20 mg

5-Amino-6-methylamino-d3-quinoline

Sign In for Pricing
View Details
Rat Monoclonal DC-SIGN/CD209 Antibody (902404) [Janelia Fluor 646]
FAB8345J 0.1 mL

Rat Monoclonal DC-SIGN/CD209 Antibody (902404) [Janelia Fluor 646]

Sign In for Pricing
View Details
CGT Polyclonal Antibody
E44H10492 100 µL

CGT Polyclonal Antibody

Sign In for Pricing
View Details
Olfr1499 siRNA (m)
sc-150619 10 µM

Olfr1499 siRNA (m)

Sign In for Pricing
View Details
MTERFD2 (MTERF4) (NM_182501) Human Over-expression Lysate
LY405521 100 µg

MTERFD2 (MTERF4) (NM_182501) Human Over-expression Lysate

Sign In for Pricing
View Details
OGFOD1 Protein Vector (Mouse) (pPB-C-His)
PV207774 500 ng

OGFOD1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details