Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Populus trichocarpa ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Populus trichocarpa ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

A4GYP6

Expression Region

1-247

Origin

Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVLSYSINTLKGLYEISGVEVGQHFYWKIGGFQVHAQVLITSWVVIVILLGSAIVTVRN PQTIPTDGQNFFEYILEFIRDVSKTQIGEEYGPWVPFIGTLFLFIFVSNWSGALLPWKII ELPHGELAAPTNDINTTVALALLTSIAYFYAGLSKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Caenorhabditis elegans ceh-21 Polyclonal Antibody
MBS7192070 Inquire

Rabbit anti-Caenorhabditis elegans ceh-21 Polyclonal Antibody

Sign In for Pricing
View Details
P120 (15D2) : m-IgG Fc BP-HRP Bundle
sc-528376 1 Kit

P120 (15D2) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
ARNTL2 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-11446R-BF555 100 µL

ARNTL2 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
PE anti-mouse CD88 (C5aR)
E16FMP088-200U 200 µg

PE anti-mouse CD88 (C5aR)

Sign In for Pricing
View Details
CD16A Monoclonal Antibody, PE Conjugated
bsm-43212M-PE 100 µL

CD16A Monoclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
MAOB Antibody
MBS9406806-01 0.05 mL

MAOB Antibody

Sign In for Pricing
View Details