Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta reflexa ATP synthase subunit a, plastid (atpI)

This Recombinant Cuscuta reflexa ATP synthase subunit a, plastid (atpI) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, plastid, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

A7M954

Expression Region

1-247

Origin

Cuscuta reflexa (Southern Asian dodder)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVLSCSIKTLKGLYDLSGVEVGQHFYWQIGDFLVHGQVLITSWVVIAILLGSATVAVRN PQTIPTVGQNLFEYVLEFIRDVSKTQIGEEYGPWVPFIGTLFLFIFVSNWSGALLPWKIL QLPHGELAAPTNDINTTVALALLTSAAYFYAGISKKGLGYFSKYIKPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFSTLAAAYIG ESMEGHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-amino-6-cyanopyridazine
TRC-A605213-50MG 50 mg

3-amino-6-cyanopyridazine

Sign In for Pricing
View Details
MAGEA1 Polyclonal Antibody
E-AB-19419-01 20 µL

MAGEA1 Polyclonal Antibody

Sign In for Pricing
View Details
MAGEA1 Polyclonal Antibody
E-AB-19419-02 60 µL

MAGEA1 Polyclonal Antibody

Sign In for Pricing
View Details
MAGEA1 Polyclonal Antibody
E-AB-19419-03 120 µL

MAGEA1 Polyclonal Antibody

Sign In for Pricing
View Details
MAGEA1 Polyclonal Antibody
E-AB-19419-04 200 µL

MAGEA1 Polyclonal Antibody

Sign In for Pricing
View Details
INSL3 (NM_005543) Human Recombinant Protein
TP309944L 1 mg

INSL3 (NM_005543) Human Recombinant Protein

Sign In for Pricing
View Details