Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta exaltata ATP synthase subunit a, plastid (atpI)

This Recombinant Cuscuta exaltata ATP synthase subunit a, plastid (atpI) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, plastid, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

A8W3B2

Expression Region

1-247

Origin

Cuscuta exaltata (Tall dodder)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVLSCSINTLKGLYDISGVEVGQHFYWQIGDFLVHGQVLITSWVVIAILLGSATVAVRN PQTIPTGGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKIL QLPHGELAAPTNDINTTVALALLTSAAYFYAGILKKGLGYFEKYIKPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMLLGLFTSGIQALIFATLAAAYIG ESMEGHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2831R), CF594 conjugate, 0.1mg/mL
BNC942831-100 1x 100 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2831R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS700845 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS701850 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Naxagolide-d7 Hydrochloride
TRC-N379802-50MG 50 mg

Naxagolide-d7 Hydrochloride

Sign In for Pricing
View Details
L-Glutamine-2,3,3,4,4-d5
TRC-G597005-25MG 25 mg

L-Glutamine-2,3,3,4,4-d5

Sign In for Pricing
View Details
Human C9orf171 (CFAP77) activation kit by CRISPRa
GA118077 1 Kit

Human C9orf171 (CFAP77) activation kit by CRISPRa

Sign In for Pricing
View Details