Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta exaltata ATP synthase subunit a, plastid (atpI)

This Recombinant Cuscuta exaltata ATP synthase subunit a, plastid (atpI) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, plastid, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

A8W3B2

Expression Region

1-247

Origin

Cuscuta exaltata (Tall dodder)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVLSCSINTLKGLYDISGVEVGQHFYWQIGDFLVHGQVLITSWVVIAILLGSATVAVRN PQTIPTGGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKIL QLPHGELAAPTNDINTTVALALLTSAAYFYAGILKKGLGYFEKYIKPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMLLGLFTSGIQALIFATLAAAYIG ESMEGHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse TRAIL/TNFSF10 (Tumor Necrosis Factor Related Apoptosis Inducing Ligand) ELISA Kit
E-EL-M1084-01 24 Tests

Mouse TRAIL/TNFSF10 (Tumor Necrosis Factor Related Apoptosis Inducing Ligand) ELISA Kit

Sign In for Pricing
View Details
Mouse TRAIL/TNFSF10 (Tumor Necrosis Factor Related Apoptosis Inducing Ligand) ELISA Kit
E-EL-M1084-02 48 Tests

Mouse TRAIL/TNFSF10 (Tumor Necrosis Factor Related Apoptosis Inducing Ligand) ELISA Kit

Sign In for Pricing
View Details
Mouse TRAIL/TNFSF10 (Tumor Necrosis Factor Related Apoptosis Inducing Ligand) ELISA Kit
E-EL-M1084-03 96 Tests

Mouse TRAIL/TNFSF10 (Tumor Necrosis Factor Related Apoptosis Inducing Ligand) ELISA Kit

Sign In for Pricing
View Details
Putative uncharacterized protein FLJ37770 (LOC100506127) (NM_001282456) Human Tagged ORF Clone
RG236966 10 µg

Putative uncharacterized protein FLJ37770 (LOC100506127) (NM_001282456) Human Tagged ORF Clone

Sign In for Pricing
View Details
Pcsk9 Mouse Gene Knockout Kit (CRISPR)
KN312980BN 1 Kit

Pcsk9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HSV1 (Herpes Simplex Virus Type I) (HSVI/2095), Biotin conjugate, 0.1mg/mL
BNCB2095-500 1x 500 µL

HSV1 (Herpes Simplex Virus Type I) (HSVI/2095), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details