Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella arizonae Cobalamin synthase (cobS)

This Recombinant Salmonella arizonae Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A9MLS7

Expression Region

1-247

Origin

Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWATLSFISRLPVPSRWAQGLDFEQYSRGIVMFPLIGAILGGLSGLIFILLQPWCG IPLAALFCILALALLTGGFHLDGLADTCDGIFSARRRERMLEIMRDSRLGTHGGLALIFV LLAKILVVSELALRGTPVLAALAAACAAGRGSAALLMYRHRYAREEGLGNVFIGKVSGRQ TCVTLGLAAIITTVLLPGMQGLAAIVITLAAIFILGQLLKRTLGGQTGDTLGAAIELGEL IFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPK14 (CPTC-MAPK14-1), CF647 conjugate, 0.1mg/mL
BNC472228-100 1x 100 µL

MAPK14 (CPTC-MAPK14-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Guanosine-13C5 5'-Monophosphate
TRC-G838514-5MG 5 mg

Guanosine-13C5 5'-Monophosphate

Sign In for Pricing
View Details
RAB10 Human Gene Knockout Kit (CRISPR)
KN201464 1 Kit

RAB10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TRPV6 Human Recombinant Protein, Synthetic Nanodisc
TP721526 10 µg

TRPV6 Human Recombinant Protein, Synthetic Nanodisc

Sign In for Pricing
View Details
AK7 (C-term) Rabbit Polyclonal Antibody
AP13650PU-N 400 µL

AK7 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MMP14 (NM_004995) Human Over-expression Lysate
LC401554 20 µg

MMP14 (NM_004995) Human Over-expression Lysate

Sign In for Pricing
View Details