Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella arizonae Cobalamin synthase (cobS)

This Recombinant Salmonella arizonae Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A9MLS7

Expression Region

1-247

Origin

Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWATLSFISRLPVPSRWAQGLDFEQYSRGIVMFPLIGAILGGLSGLIFILLQPWCG IPLAALFCILALALLTGGFHLDGLADTCDGIFSARRRERMLEIMRDSRLGTHGGLALIFV LLAKILVVSELALRGTPVLAALAAACAAGRGSAALLMYRHRYAREEGLGNVFIGKVSGRQ TCVTLGLAAIITTVLLPGMQGLAAIVITLAAIFILGQLLKRTLGGQTGDTLGAAIELGEL IFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RCN1 (NM_002901) Human Over-expression Lysate
LY419027 100 µg

RCN1 (NM_002901) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse IL-33 Recombinant Rabbit Monoclonal Antibody [PSH08-42] - BSA and Azide free (Detector)
HA722986 100 µL

Mouse IL-33 Recombinant Rabbit Monoclonal Antibody [PSH08-42] - BSA and Azide free (Detector)

Sign In for Pricing
View Details
SATB2 Rabbit Monoclonal Antibody [Clone ID: R02-1H5]
TA422154 100 µL

SATB2 Rabbit Monoclonal Antibody [Clone ID: R02-1H5]

Sign In for Pricing
View Details
CYP27A1 Polyclonal Antibody
E-AB-11121-01 20 µL

CYP27A1 Polyclonal Antibody

Sign In for Pricing
View Details
CYP27A1 Polyclonal Antibody
E-AB-11121-02 60 µL

CYP27A1 Polyclonal Antibody

Sign In for Pricing
View Details
CYP27A1 Polyclonal Antibody
E-AB-11121-03 120 µL

CYP27A1 Polyclonal Antibody

Sign In for Pricing
View Details