Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lemna minor ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Lemna minor ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

A9L984

Expression Region

1-247

Origin

Lemna minor (Common duckweed)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVIPCSINTLKGLYDISGVEVGQHLYWQIGGLQVHAQVLITSWVVIAILLGSVTLAVRN PQTIPADGQNFFEYLLEFIRDLSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLSYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTSA (N-term) Rabbit Polyclonal Antibody
AP51129PU-N 400 µL

CTSA (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LLGL2 Rabbit Polyclonal Antibody
TA378074 100 µL

LLGL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cd9 Rat Monoclonal Antibody [Clone ID: EM-04]
AM26023AC-N 100 µg

Cd9 Rat Monoclonal Antibody [Clone ID: EM-04]

Sign In for Pricing
View Details
Senecionine
TRC-S258650-2.5MG 2.5 mg

Senecionine

Sign In for Pricing
View Details
Human NUDCD1 activation kit by CRISPRa
GA113798 1 Kit

Human NUDCD1 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Mouse IL12RB2/IL12R-beta 2 Protein (Fc Tag)
PKSM041052-01 10 µg

Recombinant Mouse IL12RB2/IL12R-beta 2 Protein (Fc Tag)

Sign In for Pricing
View Details