Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella enteritidis PT4 Cobalamin synthase (cobS)

This Recombinant Salmonella enteritidis PT4 Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B5QYX4

Expression Region

1-247

Origin

Salmonella enteritidis PT4 (strain P125109)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLAFISRLPVPSRWSQGLDFEQYSRGIVMFPFIGLILGGVSGLIFILLQPWCG IPLAALFCILALALLTGGFHLDGLADTCDGIFSARRRERMLEIMRDSRLGTHGGLALIFV LLAKILVVSELALRGTPMLAALAAACAAGRGSAVLLMYRHRYAREEGLGNVFIGKVSGRQ TCITLGLAVIVATVLLPGMQGLAAMVVTCAAIFILGQLLKRTLGGQTGDTLGAAIELGEL IFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF149 Mouse Monoclonal Antibody [Clone ID: OTI9F11]
CF810509 100 µg

RNF149 Mouse Monoclonal Antibody [Clone ID: OTI9F11]

Sign In for Pricing
View Details
AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2491), CF647 conjugate, 0.1mg/mL
BNC472491-500 1x 500 µL

AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2491), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AMPK alpha 1 (PRKAA1) Rabbit Polyclonal Antibody
AP02704PU-N 100 µL

AMPK alpha 1 (PRKAA1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PCDHGA12 Human Gene Knockout Kit (CRISPR)
KN419857 1 Kit

PCDHGA12 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
APC Anti-Mouse CD49d Antibody[R1-2]
AN00422E-01 50 Tests

APC Anti-Mouse CD49d Antibody[R1-2]

Sign In for Pricing
View Details
APC Anti-Mouse CD49d Antibody[R1-2]
AN00422E-02 100 Tests

APC Anti-Mouse CD49d Antibody[R1-2]

Sign In for Pricing
View Details