Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella enteritidis PT4 Cobalamin synthase (cobS)

This Recombinant Salmonella enteritidis PT4 Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B5QYX4

Expression Region

1-247

Origin

Salmonella enteritidis PT4 (strain P125109)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLAFISRLPVPSRWSQGLDFEQYSRGIVMFPFIGLILGGVSGLIFILLQPWCG IPLAALFCILALALLTGGFHLDGLADTCDGIFSARRRERMLEIMRDSRLGTHGGLALIFV LLAKILVVSELALRGTPMLAALAAACAAGRGSAVLLMYRHRYAREEGLGNVFIGKVSGRQ TCITLGLAVIVATVLLPGMQGLAAMVVTCAAIFILGQLLKRTLGGQTGDTLGAAIELGEL IFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Renal pelvis
CS710408 5x 5 µm

Tissue FFPE Sections, Renal pelvis

Sign In for Pricing
View Details
Recombinant Tau (S396) Antibody
RC-4594-01 50 μL

Recombinant Tau (S396) Antibody

Sign In for Pricing
View Details
Recombinant Tau (S396) Antibody
RC-4594-02 100 µL

Recombinant Tau (S396) Antibody

Sign In for Pricing
View Details
Recombinant Tau (S396) Antibody
RC-4594-03 1 mL

Recombinant Tau (S396) Antibody

Sign In for Pricing
View Details
Scp2 Mouse Gene Knockout Kit (CRISPR)
KN515398 1 Kit

Scp2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ITPR2 (1152-1164) Goat Polyclonal Antibody
AP22536PU-N 50 µg

ITPR2 (1152-1164) Goat Polyclonal Antibody

Sign In for Pricing
View Details