Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella enteritidis PT4 Cobalamin synthase (cobS)

This Recombinant Salmonella enteritidis PT4 Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B5QYX4

Expression Region

1-247

Origin

Salmonella enteritidis PT4 (strain P125109)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLAFISRLPVPSRWSQGLDFEQYSRGIVMFPFIGLILGGVSGLIFILLQPWCG IPLAALFCILALALLTGGFHLDGLADTCDGIFSARRRERMLEIMRDSRLGTHGGLALIFV LLAKILVVSELALRGTPMLAALAAACAAGRGSAVLLMYRHRYAREEGLGNVFIGKVSGRQ TCITLGLAVIVATVLLPGMQGLAAMVVTCAAIFILGQLLKRTLGGQTGDTLGAAIELGEL IFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSH2 Antibody
8C13089-AAT 50 µg

MSH2 Antibody

Sign In for Pricing
View Details
Human HELT activation kit by CRISPRa
GA118216 1 Kit

Human HELT activation kit by CRISPRa

Sign In for Pricing
View Details
Fluo-8L™, sodium salt
21098-AAT 10x 50 µg

Fluo-8L™, sodium salt

Sign In for Pricing
View Details
CD41 Recombinant Rabbit monoclonal Antibody
HA751201 100 µL

CD41 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CKAP1 (TBCB) Rabbit Polyclonal Antibody
TA365653 100 µL

CKAP1 (TBCB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Androst-4-ene-3,6,17-trione
TRC-A637565-5MG 5 mg

Androst-4-ene-3,6,17-trione

Sign In for Pricing
View Details