Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Cobalamin synthase (cobS)

This Recombinant Escherichia coli Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B6I829

Expression Region

1-247

Origin

Escherichia coli (strain SE11)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLSFITRLPVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMVLQAWCG VPLAALFSVLVLALMTGGFHLDGLADTCDGVFSARSRDRMLEIMRDSRLGTHGGLALIFV VLAKILVLSELALRGEPILASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQ TCVTLGLAAIFAAVLLPGMHGVAAMVVTMVAIFILGQLLKRTLGGQTGDTLGAAIELGEL VFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHRNB4-set siRNA/shRNA/RNAi Lentivector (Human)
16133091 4x 500 ng

CHRNB4-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
HAT-Tag
370847 100 µg

HAT-Tag

Sign In for Pricing
View Details
Lentiviral mouse Ago3 shRNA (UAS) - Lentiviral mouse Ago3 shRNA (UAS, iRFP) plasmid
GTR15268732 1 Vial

Lentiviral mouse Ago3 shRNA (UAS) - Lentiviral mouse Ago3 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Human Serine/Threonine Kinase 39 (STK39) ELISA Kit
DLR-STK39-Hu-96T 96 Tests

Human Serine/Threonine Kinase 39 (STK39) ELISA Kit

Sign In for Pricing
View Details
Sheep Protein pellino homolog 1 ELISA Kit
MBS753652-01 48 Well

Sheep Protein pellino homolog 1 ELISA Kit

Sign In for Pricing
View Details
Sheep Protein pellino homolog 1 ELISA Kit
MBS753652-02 96 Well

Sheep Protein pellino homolog 1 ELISA Kit

Sign In for Pricing
View Details