Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella heidelberg Cobalamin synthase (cobS)

This Recombinant Salmonella heidelberg Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B4T8W9

Expression Region

1-247

Origin

Salmonella heidelberg (strain SL476)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLAFISRLPVPSRWSQGLDFEQYSRGIVMFPFIGLILGGVSGLIFILLQPWCG IPLAALFCILALALLTGGFHLDGLADTCDGIFSARRRERMLEIMRDSRLGTHGGLALIFV LLAKILVVSELALRGTPMLAALAAACAAGRGSAVLLMYRHRYAREEGLGNVFIGKVSGRQ TCITLGLAVIVATVLLPGMQGLAAMVVTCAAIFILGQLLKRTLGGQTGDTLGAAIELGEL IFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL
BNC401073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL
BNC741003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF740 conjugate, 0.1mg/mL
BNC740342-100 1x 100 µL

CD43 (84-3C1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1526), CF640R conjugate, 0.1mg/mL
BNC401526-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1526), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (K8.8), CF488A conjugate, 0.1mg/mL
BNC880689-100 1x 100 µL

Cytokeratin 8 (K8.8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1893), CF568 conjugate, 0.1mg/mL
BNC681893-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/1893), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details