Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella dublin Cobalamin synthase (cobS)

This Recombinant Salmonella dublin Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B5FLY5

Expression Region

1-247

Origin

Salmonella dublin (strain CT_02021853)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLAFISRLPVPSRWSQGLDFEQYSRGIVMFPFIGLILGGVSGLIFILLQPWCG IPLAALFCILALALLTGGFHLDGLADTCDGIFSARRRERMLEIMRDSRLGTHGGLALIFV LLAKILVVSELALRGTPMLAALAAACAAGRGSAVLLMYRHRYAREEGLGNVFIGKVSGRQ TCITLGLAVIVATVLLPGMQGLAAMVVTCAAIFILGQLLKRTLGGQTGDTLGAAIELGEL IFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPTX2 (NM_002523) Human Recombinant Protein
TP306713M 100 µg

NPTX2 (NM_002523) Human Recombinant Protein

Sign In for Pricing
View Details
Orthopedic Traction bed BHBD-606
BHBD-606 1 Unit

Orthopedic Traction bed BHBD-606

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (2F6), 0.2mg/mL
BNUB1014-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (2F6), 0.2mg/mL

Sign In for Pricing
View Details
ALKBH1 Mouse Monoclonal Antibody [Clone ID: OTI1B8]
CF805682 100 µg

ALKBH1 Mouse Monoclonal Antibody [Clone ID: OTI1B8]

Sign In for Pricing
View Details
Cytokeratin, LMW (KRTL/1077), CF594 conjugate, 0.1mg/mL
BNC941077-500 1x 500 µL

Cytokeratin, LMW (KRTL/1077), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cntnap1 Mouse Gene Knockout Kit (CRISPR)
KN503587 1 Kit

Cntnap1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details