Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella dublin Cobalamin synthase (cobS)

This Recombinant Salmonella dublin Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B5FLY5

Expression Region

1-247

Origin

Salmonella dublin (strain CT_02021853)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLAFISRLPVPSRWSQGLDFEQYSRGIVMFPFIGLILGGVSGLIFILLQPWCG IPLAALFCILALALLTGGFHLDGLADTCDGIFSARRRERMLEIMRDSRLGTHGGLALIFV LLAKILVVSELALRGTPMLAALAAACAAGRGSAVLLMYRHRYAREEGLGNVFIGKVSGRQ TCITLGLAVIVATVLLPGMQGLAAMVVTCAAIFILGQLLKRTLGGQTGDTLGAAIELGEL IFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Soft tissue
CS714368 5x 5 µm

Tissue FFPE Sections, Soft tissue

Sign In for Pricing
View Details
Monkey αFP Antibody Pair Set
E-KAB-0653 50 µL & 100 µg

Monkey αFP Antibody Pair Set

Sign In for Pricing
View Details
FRAT2 Human Gene Knockout Kit (CRISPR)
KN402492 1 Kit

FRAT2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BARD1 Antibody
8C13026-AAT 50 µg

BARD1 Antibody

Sign In for Pricing
View Details
TPEN
SIH-231-500MG 500 mg

TPEN

Sign In for Pricing
View Details
RNF5 (N-term) Rabbit Polyclonal Antibody
AP18182PU-N 400 µL

RNF5 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details