Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Cobalamin synthase (cobS)

This Recombinant Escherichia coli Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B7L917

Expression Region

1-247

Origin

Escherichia coli (strain 55989 / EAEC)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLSFITRLPVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMVLQAWCG VPLAALFSVLVLALMTGGFHLDGLADTCDGVFSARSRDRMLEIMRDSRLGTHGGLALIFV VLAKILVLSELALRGEPILASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQ TCVTLGLAAIFAAVLLPGMHGVAAMVVTMVAIFILGQLLKRTLGGQTGDTLGAAIELGEL VFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PON2 Antibody
OC-609-01 50 μL

PON2 Antibody

Sign In for Pricing
View Details
PON2 Antibody
OC-609-02 100 µL

PON2 Antibody

Sign In for Pricing
View Details
PON2 Antibody
OC-609-03 1 mL

PON2 Antibody

Sign In for Pricing
View Details
NSC 379317
TRC-N900295-100MG 100 mg

NSC 379317

Sign In for Pricing
View Details
MEOX 2 (MEOX2) (NM_005924) Human Recombinant Protein
TP760062 50 µg

MEOX 2 (MEOX2) (NM_005924) Human Recombinant Protein

Sign In for Pricing
View Details
TMEM229A Human Gene Knockout Kit (CRISPR)
KN427342 1 Kit

TMEM229A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details