Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Cobalamin synthase (cobS)

This Recombinant Escherichia coli Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B7L917

Expression Region

1-247

Origin

Escherichia coli (strain 55989 / EAEC)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLSFITRLPVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMVLQAWCG VPLAALFSVLVLALMTGGFHLDGLADTCDGVFSARSRDRMLEIMRDSRLGTHGGLALIFV VLAKILVLSELALRGEPILASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQ TCVTLGLAAIFAAVLLPGMHGVAAMVVTMVAIFILGQLLKRTLGGQTGDTLGAAIELGEL VFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (T-Cell Marker) (C3e/2479), CF488A conjugate, 0.1mg/mL
BNC882479-100 1x 100 µL

CD3e (T-Cell Marker) (C3e/2479), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
APMAP (NM_020531) Human Over-expression Lysate
LY402795 100 µg

APMAP (NM_020531) Human Over-expression Lysate

Sign In for Pricing
View Details
Histidase (HAL) (NM_002108) Human Over-expression Lysate
LC419526 20 µg

Histidase (HAL) (NM_002108) Human Over-expression Lysate

Sign In for Pricing
View Details
CD147 (BSG) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E11]
TA501162BM 100 µL

CD147 (BSG) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E11]

Sign In for Pricing
View Details
1,3-Bis(4-isobutoxybenzyl)urea
TRC-B448763-50MG 50 mg

1,3-Bis(4-isobutoxybenzyl)urea

Sign In for Pricing
View Details
MTX1 Human Gene Knockout Kit (CRISPR)
KN400800 1 Kit

MTX1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details