Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli O8 Cobalamin synthase (cobS)

This Recombinant Escherichia coli O8 Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B7M3C8

Expression Region

1-247

Origin

Escherichia coli O8 (strain IAI1)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLSFITRLPVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMVLQAWCG VPLAALFSVLVLALMTGGFHLDGLADTCDGVFSARSRDRMLEIMRDSRLGTHGGLALIFV VLAKILVLSELALRGEPILASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQ TCVTLGLAAIFAAVLLPGMHGVAAMVVTMVAIFILGQLLKRTLGGQTGDTLGAAIELGEL VFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ISLR2 Antibody
KC-8006-01 50 μL

ISLR2 Antibody

Sign In for Pricing
View Details
ISLR2 Antibody
KC-8006-02 100 µL

ISLR2 Antibody

Sign In for Pricing
View Details
ISLR2 Antibody
KC-8006-03 1 mL

ISLR2 Antibody

Sign In for Pricing
View Details
Ro 67-4853
TRC-R637400-25MG 25 mg

Ro 67-4853

Sign In for Pricing
View Details
RING2 Recombinant Rabbit Monoclonal Antibody [JB38-41]
ET7107-07 100 µL

RING2 Recombinant Rabbit Monoclonal Antibody [JB38-41]

Sign In for Pricing
View Details
Human RAB39 (RAB39A) activation kit by CRISPRa
GA110233 1 Kit

Human RAB39 (RAB39A) activation kit by CRISPRa

Sign In for Pricing
View Details