Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi C Cobalamin synthase (cobS)

This Recombinant Salmonella paratyphi C Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

C0Q1Q9

Expression Region

1-247

Origin

Salmonella paratyphi C (strain RKS4594)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLAFISRLPVPSRWSQGLDFEQYSRGIVMFPFIGLILGGVSGLIFILLQSWCG IPLAALFCILALALLTGGFHLDGLADTCDGIFSARRRERMLEIMRDSRLGTHGGLALIFV LLTKILVVSELALRGTPMLAALAAACAAGRGSAVLLMYRHRYAREEGLGNVFIGKVSGRQ TCITLGLAVIVATVLLPGMQGLAAMVVTCAAIFILGQLLKRTLGGQTGDTLGAAIELGEL IFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD300e/LMIR6 Antibody (UP-H2) [DyLight 680]
NBP2-62230FR 0.1 mL

Mouse Monoclonal CD300e/LMIR6 Antibody (UP-H2) [DyLight 680]

Sign In for Pricing
View Details
Recombinant Mouse Glutathione S-transferase Mu 1 (Gstm1)
MBS965204-01 0.02 mg (E-Coli)

Recombinant Mouse Glutathione S-transferase Mu 1 (Gstm1)

Sign In for Pricing
View Details
Recombinant Mouse Glutathione S-transferase Mu 1 (Gstm1)
MBS965204-02 0.1 mg (E-Coli)

Recombinant Mouse Glutathione S-transferase Mu 1 (Gstm1)

Sign In for Pricing
View Details
Recombinant Mouse Glutathione S-transferase Mu 1 (Gstm1)
MBS965204-03 1 mg (E-Coli)

Recombinant Mouse Glutathione S-transferase Mu 1 (Gstm1)

Sign In for Pricing
View Details
Recombinant Mouse Glutathione S-transferase Mu 1 (Gstm1)
MBS965204-04 5x 1 mg (E-Coli)

Recombinant Mouse Glutathione S-transferase Mu 1 (Gstm1)

Sign In for Pricing
View Details
Mouse Kctd2 Pre-designed siRNA Set A
SI107108A 1 Each

Mouse Kctd2 Pre-designed siRNA Set A

Sign In for Pricing
View Details