Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi C Cobalamin synthase (cobS)

This Recombinant Salmonella paratyphi C Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

C0Q1Q9

Expression Region

1-247

Origin

Salmonella paratyphi C (strain RKS4594)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLAFISRLPVPSRWSQGLDFEQYSRGIVMFPFIGLILGGVSGLIFILLQSWCG IPLAALFCILALALLTGGFHLDGLADTCDGIFSARRRERMLEIMRDSRLGTHGGLALIFV LLTKILVVSELALRGTPMLAALAAACAAGRGSAVLLMYRHRYAREEGLGNVFIGKVSGRQ TCITLGLAVIVATVLLPGMQGLAAMVVTCAAIFILGQLLKRTLGGQTGDTLGAAIELGEL IFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Connexin 43/GJA1 Rabbit pAb
GB11234-100 100 μL

Anti-Connexin 43/GJA1 Rabbit pAb

Sign In for Pricing
View Details
HRPT2 Recombinant Antibody, PE-Cy7 Conjugated
bsm-62815R-PE-Cy7 100 µL

HRPT2 Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
OTUD1, ID (OTUD1, DUBA7, OTDC1, OTU domain-containing protein 1, DUBA-7) (FITC)
MBS6329892-01 0.2 mL

OTUD1, ID (OTUD1, DUBA7, OTDC1, OTU domain-containing protein 1, DUBA-7) (FITC)

Sign In for Pricing
View Details
OTUD1, ID (OTUD1, DUBA7, OTDC1, OTU domain-containing protein 1, DUBA-7) (FITC)
MBS6329892-02 5x 0.2 mL

OTUD1, ID (OTUD1, DUBA7, OTDC1, OTU domain-containing protein 1, DUBA-7) (FITC)

Sign In for Pricing
View Details
RPS27AP9 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV784649 1.0 µg DNA

RPS27AP9 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
6-Amino-5- (4-sulfonamidobenzoyl) -N- (methylamino) -1-methyluracil
258399-01 50 mg

6-Amino-5- (4-sulfonamidobenzoyl) -N- (methylamino) -1-methyluracil

Sign In for Pricing
View Details