Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Cobalamin synthase (cobS)

This Recombinant Escherichia coli Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

C4ZQQ5

Expression Region

1-247

Origin

Escherichia coli (strain K12 / MC4100 / BW2952)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLSFITRLPVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMVLQAWCG APLAALFSVLVLVLMTGGFHLDGLADTCDGVFSARSRDRMLEIMRDSRLGTHGGLALIFV VLAKILVLSELALRGESILASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQ TCVTLGLAAIFAAVLLPGMHGVAAMVVTMVAIFILGQLLKRTLGGQTGDTLGAAIELGEL VFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FKBP52 (FKBP4) Human Gene Knockout Kit (CRISPR)
KN400713 1 Kit

FKBP52 (FKBP4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Myomegalin Rabbit Polyclonal Antibody
ER2001-16 100 µL

Myomegalin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
COX17 Rabbit Polyclonal Antibody
AP20541PU-N 100 µg

COX17 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OMP Antibody
KC-3276-01 50 μL

OMP Antibody

Sign In for Pricing
View Details
OMP Antibody
KC-3276-02 100 µL

OMP Antibody

Sign In for Pricing
View Details
OMP Antibody
KC-3276-03 1 mL

OMP Antibody

Sign In for Pricing
View Details