Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Cobalamin synthase (cobS)

This Recombinant Escherichia coli Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

C4ZQQ5

Expression Region

1-247

Origin

Escherichia coli (strain K12 / MC4100 / BW2952)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLSFITRLPVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMVLQAWCG APLAALFSVLVLVLMTGGFHLDGLADTCDGVFSARSRDRMLEIMRDSRLGTHGGLALIFV VLAKILVLSELALRGESILASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQ TCVTLGLAAIFAAVLLPGMHGVAAMVVTMVAIFILGQLLKRTLGGQTGDTLGAAIELGEL VFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OVOL2 activation kit by CRISPRa
GA111778 1 Kit

Human OVOL2 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human BMP-7 protein (His Tag)
PKSH034133-01 20 µg

Recombinant Human BMP-7 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human BMP-7 protein (His Tag)
PKSH034133-02 100 µg

Recombinant Human BMP-7 protein (His Tag)

Sign In for Pricing
View Details
Human QPRT activation kit by CRISPRa
GA108332 1 Kit

Human QPRT activation kit by CRISPRa

Sign In for Pricing
View Details
ENOX1 (NM_001127615) Human Recombinant Protein
TP326055M 100 µg

ENOX1 (NM_001127615) Human Recombinant Protein

Sign In for Pricing
View Details
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), CF568 conjugate, 0.1mg/mL
BNC681577-100 1x 100 µL

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details