Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Cobalamin synthase (cobS)

This Recombinant Escherichia coli Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B1IZQ8

Expression Region

1-247

Origin

Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLSFITRLPVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMVLQAWCG VPLAALFSVLVLALMTGGFHLDGLADTCDGVFSARSRDCMLEIMRDSRLGTHGGLALIFV VLAKILVLSELALRGEPSLASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQ TCVTLGLAAIFAAVLLPGMHGVAAMVVTMVAIFILGQLLKRTLGGQTGDTLGAAIELGEL VFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARID3A Antibody
E306528 100 µg - 200 µL

ARID3A Antibody

Sign In for Pricing
View Details
MRPL30 sgRNA CRISPR Lentivector set (Human)
K1329101 3x 1.0 µg

MRPL30 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal Rit1 Antibody
NBP2-49075 0.1 mL

Rabbit Polyclonal Rit1 Antibody

Sign In for Pricing
View Details
Cleaved-Notch 2 (V1697)
311200-01 50 µg

Cleaved-Notch 2 (V1697)

Sign In for Pricing
View Details
Cleaved-Notch 2 (V1697)
311200-02 100 µg

Cleaved-Notch 2 (V1697)

Sign In for Pricing
View Details
4 Antibody
MBS7161958 10 mg

4 Antibody

Sign In for Pricing
View Details