Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Cobalamin synthase (cobS)

This Recombinant Escherichia coli Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B1X6T0

Expression Region

1-247

Origin

Escherichia coli (strain K12 / DH10B)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLSFITRLPVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMVLQAWCG APLAALFSVLVLVLMTGGFHLDGLADTCDGVFSARSRDRMLEIMRDSRLGTHGGLALIFV VLAKILVLSELALRGESILASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQ TCVTLGLAAIFAAVLLPGMHGVAAMVVTMVAIFILGQLLKRTLGGQTGDTLGAAIELGEL VFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmfbp1 (NM_134393) Rat Tagged Lenti ORF Clone
RR205613L3 10 µg

Pmfbp1 (NM_134393) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
AP1B1 discontinued
385899 200 µL

AP1B1 discontinued

Sign In for Pricing
View Details
DPY30 Protein Vector (Mouse) (pPB-C-His)
PV173342 500 ng

DPY30 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
RIMS3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
39597124 3x 1.0µg DNA

RIMS3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
pUNO1-mIRAK4
puno1-mirak4 20 µg

pUNO1-mIRAK4

Sign In for Pricing
View Details
IQGAP3 Rabbit Polyclonal Antibody
TA377552 100 µL

IQGAP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details