Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 41A (Tmem41a)

This Recombinant Mouse Transmembrane protein 41A (Tmem41a) spans the amino acid sequence from region 18-264.

Product Specifications

Product Name Alternative

Transmembrane protein 41A

UniProt

Q9D8U2

Expression Region

18-264

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LYLLSTRLPLGPRLAAAGEPEGRSLWFPSDLAELRELSEVLREYRKEHQAYVFLLFCSAY LYKQGFAIPGSSFLNVLAGALFGPWLGLLLCCVLTSVGATGCYLLSSLFGKQLVISYFPD KVALLQKKVEENRNSLFFFLLFLRLFPMTPNWFLNLSAPILNIPIVQFFFSVLIGLIPYN FICVQTGSILSTLTSLDALFSWETVLKLLAIALVALVPGTLIKKFSQKRLALSETSDIGH PDRRKDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal PBR Antibody (CL13358)
NBP3-18560-100ul 100 µL

Mouse Monoclonal PBR Antibody (CL13358)

Sign In for Pricing
View Details
Tenascin-R Polyclonal Antibody
E11-2035915 100 µg -100 µL

Tenascin-R Polyclonal Antibody

Sign In for Pricing
View Details
NDUFA5 Antibody, HRP conjugated
CSB-PA614988LB01HU-01 50 µg

NDUFA5 Antibody, HRP conjugated

Sign In for Pricing
View Details
NDUFA5 Antibody, HRP conjugated
CSB-PA614988LB01HU-02 100 µg

NDUFA5 Antibody, HRP conjugated

Sign In for Pricing
View Details
Recombinant Acidianus filamentous virus 2 Uncharacterized protein ORF72 (ORF72)
MBS1448493-01 0.02 mg (E-Coli)

Recombinant Acidianus filamentous virus 2 Uncharacterized protein ORF72 (ORF72)

Sign In for Pricing
View Details
Recombinant Acidianus filamentous virus 2 Uncharacterized protein ORF72 (ORF72)
MBS1448493-02 0.1 mg (E-Coli)

Recombinant Acidianus filamentous virus 2 Uncharacterized protein ORF72 (ORF72)

Sign In for Pricing
View Details