Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 41A (Tmem41a)

This Recombinant Mouse Transmembrane protein 41A (Tmem41a) spans the amino acid sequence from region 18-264.

Product Specifications

Product Name Alternative

Transmembrane protein 41A

UniProt

Q9D8U2

Expression Region

18-264

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LYLLSTRLPLGPRLAAAGEPEGRSLWFPSDLAELRELSEVLREYRKEHQAYVFLLFCSAY LYKQGFAIPGSSFLNVLAGALFGPWLGLLLCCVLTSVGATGCYLLSSLFGKQLVISYFPD KVALLQKKVEENRNSLFFFLLFLRLFPMTPNWFLNLSAPILNIPIVQFFFSVLIGLIPYN FICVQTGSILSTLTSLDALFSWETVLKLLAIALVALVPGTLIKKFSQKRLALSETSDIGH PDRRKDA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RNF34 protein
orb755735-01 50 µg

Human RNF34 protein

Sign In for Pricing
View Details
Human RNF34 protein
orb755735-02 100 µg

Human RNF34 protein

Sign In for Pricing
View Details
Human RNF34 protein
orb755735-03 200 µg

Human RNF34 protein

Sign In for Pricing
View Details
Human RNF34 protein
orb755735-04 1 mg

Human RNF34 protein

Sign In for Pricing
View Details
Mouse Ppp1r3b Pre-designed siRNA Set A
SI111032A 1 Each

Mouse Ppp1r3b Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Human Tetraspanin-17 (TSPAN17)
orb2916598-01 20 µg

Recombinant Human Tetraspanin-17 (TSPAN17)

Sign In for Pricing
View Details