Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Transmembrane protein 41A (TMEM41A)

This Recombinant Bovine Transmembrane protein 41A (TMEM41A) spans the amino acid sequence from region 18-264.

Product Specifications

Product Name Alternative

Transmembrane protein 41A

UniProt

Q08D99

Expression Region

18-264

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LYLLSTRLPRASTLVSAEESGDRSLWFPSDLAELRELSEVLREYRKEHQVYVFLLFCSAY LYKQSFAIPGSSFLNVLAGALFGPWLGLLLCCVLTSVGATGCYLLSSVFGKQLVVFYFPD KVALLQKKVEENRNGLFFFLLFLRLFPMTPNWFLNLSAPILNIPIVQFFFSVLIGLIPYN FICVQTGSILSTLTSLDALFSWETAFKLLAIALVALVPGTLIKKFSQKDLRLKETSNTHS LNSRKVT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (BU45), CF647 conjugate, 0.1mg/mL
BNC470189-500 1x 500 µL

CD74 (BU45), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF555 conjugate, 0.1mg/mL
BNC550039-100 1x 100 µL

CD34 (ICO-115), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL
BNC881050-100 1x 100 µL

CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Plasma Cell Marker (LIV3G11, same as 7B18), CF740 conjugate, 0.1mg/mL
BNC740047-500 1x 500 µL

Plasma Cell Marker (LIV3G11, same as 7B18), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (PCRP-SOX9-1A2), CF488A conjugate, 0.1mg/mL
BNC881927-500 1x 500 µL

SOX9 / SRY-box 9 (PCRP-SOX9-1A2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100B (S100B/1012), CF568 conjugate, 0.1mg/mL
BNC681012-500 1x 500 µL

S100B (S100B/1012), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details