Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nandina domestica ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Nandina domestica ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

Q09FX3

Expression Region

1-247

Origin

Nandina domestica (Heavenly bamboo)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVLPCSINTLKGLYEISGVEVGQHFYWQIGGFQVHAQVLITSWVVMAILLGSATIVVRN PQTIPTDGQNFFEYVLEFIRDLSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALPTSVAYFYAGLTKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL
BNC740633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1a (O10), CF640R conjugate, 0.1mg/mL
BNC400667-100 1x 100 µL

CD1a (O10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL
BNC940978-100 1x 100 µL

CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2427), CF405S conjugate, 0.1mg/mL
BNC042427-100 1x 100 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2427), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/2590), CF647 conjugate, 0.1mg/mL
BNC472590-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/2590), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100B (4C4.9), CF740 conjugate, 0.1mg/mL
BNC740143-500 1x 500 µL

S100B (4C4.9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details