Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Citrus sinensis ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Citrus sinensis ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

Q09MJ0

Expression Region

1-247

Origin

Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVLSCSMNTLRGLYDISGVEVGQHFYWQIGGFQVHAQVLITSWVVIAILLGSAFIAVRN PQTVPTATQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTLFLFIFVSNWSGALLPWKII ELPHGELAAPTNDINTTVALALLTSIAYFYAGLSKKGLGYFSKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Metol
TRC-M338720-5G 5 g

Metol

Sign In for Pricing
View Details
Recombinant Mouse VEGFR3/FLT4 Protein (His Tag)
PKSM040596-01 100 µg

Recombinant Mouse VEGFR3/FLT4 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse VEGFR3/FLT4 Protein (His Tag)
PKSM040596-02 1 mg

Recombinant Mouse VEGFR3/FLT4 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant SMPD3 Antibody
RN-13691-01 50 μL

Recombinant SMPD3 Antibody

Sign In for Pricing
View Details
Recombinant SMPD3 Antibody
RN-13691-02 100 µL

Recombinant SMPD3 Antibody

Sign In for Pricing
View Details
Recombinant SMPD3 Antibody
RN-13691-03 1 mL

Recombinant SMPD3 Antibody

Sign In for Pricing
View Details