Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella flexneri serotype 5b Cobalamin synthase (cobS)

This Recombinant Shigella flexneri serotype 5b Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q0T3C3

Expression Region

1-247

Origin

Shigella flexneri serotype 5b (strain 8401)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLSFITRLPVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMVLQAWCG APLAALFSVLVLALMTGEFHLDGLADTCDGVFSARSRDRMLEIMRDSRLGTHGGLALIFV VLAKILVLSELALRGEPILASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQ TCVTLGLAAIFAAVLLLGMHGVAAMVVTMVAIFILGQLLKRTLDGQTGDTLGAAIELGEL VFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Chloro-3-indolyl-β-D-glucuronide cyclohexylammonium salt
sc-221093 250 mg

6-Chloro-3-indolyl-β-D-glucuronide cyclohexylammonium salt

Sign In for Pricing
View Details
PCSK9 3'UTR GFP Stable Cell Line
TU067595 1.0 mL

PCSK9 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
FAM118B Antibody, HRP conjugated
A66206-50UG 50 µg

FAM118B Antibody, HRP conjugated

Sign In for Pricing
View Details
Canine Leukocyte antigen B ELISA kit
GTR10458302 96 Well

Canine Leukocyte antigen B ELISA kit

Sign In for Pricing
View Details
Mouse Fam60a / Protein FAM60A Recombinant Protein
R15272m 1 Each

Mouse Fam60a / Protein FAM60A Recombinant Protein

Sign In for Pricing
View Details
ELISA Kit For Melanoregulin
E13873m 96 Tests

ELISA Kit For Melanoregulin

Sign In for Pricing
View Details