Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella flexneri serotype 5b Cobalamin synthase (cobS)

This Recombinant Shigella flexneri serotype 5b Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q0T3C3

Expression Region

1-247

Origin

Shigella flexneri serotype 5b (strain 8401)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLSFITRLPVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMVLQAWCG APLAALFSVLVLALMTGEFHLDGLADTCDGVFSARSRDRMLEIMRDSRLGTHGGLALIFV VLAKILVLSELALRGEPILASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQ TCVTLGLAAIFAAVLLLGMHGVAAMVVTMVAIFILGQLLKRTLDGQTGDTLGAAIELGEL VFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Tasp1 shRNA (UAS) - Lentiviral mouseTasp1 shRNA (UAS, GFP) (25)
GTR15276152 1 Vial

Lentiviral mouse Tasp1 shRNA (UAS) - Lentiviral mouseTasp1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Monkey GDP Dissociation Inhibitor 1 (GDI1) ELISA Kit
abx358756-01 96 Tests

Monkey GDP Dissociation Inhibitor 1 (GDI1) ELISA Kit

Sign In for Pricing
View Details
Monkey GDP Dissociation Inhibitor 1 (GDI1) ELISA Kit
abx358756-02 5x 96 Tests

Monkey GDP Dissociation Inhibitor 1 (GDI1) ELISA Kit

Sign In for Pricing
View Details
Monkey GDP Dissociation Inhibitor 1 (GDI1) ELISA Kit
abx358756-03 10x 96 Tests

Monkey GDP Dissociation Inhibitor 1 (GDI1) ELISA Kit

Sign In for Pricing
View Details
POEM (G-1) HRP
sc-393033 HRP 200 µg/mL

POEM (G-1) HRP

Sign In for Pricing
View Details
Magic™ Membrane Protein Human CACNG7 (Calcium voltage-gated channel auxiliary subunit gamma 7) Full Length
MPC0442K Each

Magic™ Membrane Protein Human CACNG7 (Calcium voltage-gated channel auxiliary subunit gamma 7) Full Length

Sign In for Pricing
View Details