Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Populus alba ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Populus alba ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

Q14FG9

Expression Region

1-247

Origin

Populus alba (White poplar)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVLSYSINTLEGLYEISGVEVGQHFYWKIGGFQVHAQVLITSWVVIVILLGSAIVTVRN PQTIPTDGQNFFEYILEFIRDVSKTQIGEEYGPWVPFIGTLFLFIFVSNWSGALLPWKII ELPHGELAAPTNDINTTVALALLTSIAYFYAGLSKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPSVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse KRT80 Protein, His (Fc)-Avi-tagged
KRT80-4942M 50 µg

Recombinant Mouse KRT80 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
BrdU (Proliferation Marker) Polyclonal Antibody, Cy5.5 Conjugated
bs-0917R-Cy5.5 100 µL

BrdU (Proliferation Marker) Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
LRRC34 (NM_001172779) Human Over-expression Lysate
LC433129 20 µg

LRRC34 (NM_001172779) Human Over-expression Lysate

Sign In for Pricing
View Details
SATB1 Peptide
4631P 0.05 mg

SATB1 Peptide

Sign In for Pricing
View Details
Use1 Peptide (AAP37352)
AAP37352-100UG 100 µg

Use1 Peptide (AAP37352)

Sign In for Pricing
View Details
Mouse Presynaptic Membrane Receptor Antibody ELISA Kit
MBS006331-01 48 Well

Mouse Presynaptic Membrane Receptor Antibody ELISA Kit

Sign In for Pricing
View Details