Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Solanum lycopersicum ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Solanum lycopersicum ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

Q2MIB2

Expression Region

1-247

Origin

Solanum lycopersicum (Tomato) (Lycopersicon esculentum)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVLSCSINTLKGLYDISGVEVGQHFYWQIGGFQVHGQVLITSWVVIAILLGSATIAVRN PQTIPTGGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSVAYFYAGLTKRGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMLLGLFTSGIQALIFATLAAAYIG ESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ubiquitin (Autophagy Marker) (UBB/2122), Biotin conjugate, 0.1mg/mL
BNCB2122-500 1x 500 µL

Ubiquitin (Autophagy Marker) (UBB/2122), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ATRX Antibody
KC-2473-01 50 μL

ATRX Antibody

Sign In for Pricing
View Details
ATRX Antibody
KC-2473-02 100 µL

ATRX Antibody

Sign In for Pricing
View Details
ATRX Antibody
KC-2473-03 1 mL

ATRX Antibody

Sign In for Pricing
View Details
IL17F Mouse Monoclonal Antibody [Clone ID: B-C52]
AM33382AF-N 500 µg

IL17F Mouse Monoclonal Antibody [Clone ID: B-C52]

Sign In for Pricing
View Details
1,2-Dichloropropane
TRC-D434520-1G 1 g

1,2-Dichloropropane

Sign In for Pricing
View Details