Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Solanum lycopersicum ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Solanum lycopersicum ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

Q2MIB2

Expression Region

1-247

Origin

Solanum lycopersicum (Tomato) (Lycopersicon esculentum)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVLSCSINTLKGLYDISGVEVGQHFYWQIGGFQVHGQVLITSWVVIAILLGSATIAVRN PQTIPTGGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSVAYFYAGLTKRGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMLLGLFTSGIQALIFATLAAAYIG ESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Genomic DNA, Esophagus
CD563416 5 µg

Tissue Genomic DNA, Esophagus

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/760), 1mg/mL
BNUM0760-50 1x 50 µL

Cytokeratin 7 (KRT7/760), 1mg/mL

Sign In for Pricing
View Details
TGFalpha (TGFA/1119), CF640R conjugate, 0.1mg/mL
BNC401119-500 1x 500 µL

TGFalpha (TGFA/1119), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometrium
CS701057 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
SHARP2 (BHLHE40) (N-term) Rabbit Polyclonal Antibody
AP50374PU-N 400 µL

SHARP2 (BHLHE40) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD134, Mouse (OX40) (OX-86), CF640R conjugate, 0.1mg/mL
BNC402004-500 1x 500 µL

CD134, Mouse (OX40) (OX-86), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details