Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Solanum lycopersicum ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Solanum lycopersicum ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

Q2MIB2

Expression Region

1-247

Origin

Solanum lycopersicum (Tomato) (Lycopersicon esculentum)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVLSCSINTLKGLYDISGVEVGQHFYWQIGGFQVHGQVLITSWVVIAILLGSATIAVRN PQTIPTGGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSVAYFYAGLTKRGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMLLGLFTSGIQALIFATLAAAYIG ESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Amino-7-nitrofluorene
TRC-A618405-250MG 250 mg

2-Amino-7-nitrofluorene

Sign In for Pricing
View Details
Rp1 Mouse Gene Knockout Kit (CRISPR)
KN514990 1 Kit

Rp1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mitocondrial Translational Initiation Factor 3 (MTIF3) (NM_001166261) Human Over-expression Lysate
LY432812 100 µg

Mitocondrial Translational Initiation Factor 3 (MTIF3) (NM_001166261) Human Over-expression Lysate

Sign In for Pricing
View Details
Sodium Iron EDTA
TRC-S634990-10G 10 g

Sodium Iron EDTA

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), Biotin conjugate, 0.1mg/mL
BNCB0017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human DNAAF8 activation kit by CRISPRa
GA115568 1 Kit

Human DNAAF8 activation kit by CRISPRa

Sign In for Pricing
View Details