Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycine max ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Glycine max ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

Q2PMT1

Expression Region

1-247

Origin

Glycine max (Soybean) (Glycine hispida)

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVLLCSINTLKRLYDISAVEVGQHFYWQIGSFQVHAQVLITSWVVIALLLVSAILIIRN LQTIPAFGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTLFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSIAYFYAGLSKKGLAYFNKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Desmin (Muscle Cell Marker) (DES/1711), 0.2mg/mL
BNUB1711-100 1x 100 µL

Desmin (Muscle Cell Marker) (DES/1711), 0.2mg/mL

Sign In for Pricing
View Details
Biotin Anti-Human CD86 Antibody[BU63]
E-AB-F1012B-01 25 µg

Biotin Anti-Human CD86 Antibody[BU63]

Sign In for Pricing
View Details
Biotin Anti-Human CD86 Antibody[BU63]
E-AB-F1012B-02 100 µg

Biotin Anti-Human CD86 Antibody[BU63]

Sign In for Pricing
View Details
CCT6B (NM_001193530) Human Over-expression Lysate
LY434266 100 µg

CCT6B (NM_001193530) Human Over-expression Lysate

Sign In for Pricing
View Details
Floor Type High Speed Refrigerated Centrifuge BCFHR-305
BCFHR-305 1 Unit

Floor Type High Speed Refrigerated Centrifuge BCFHR-305

Sign In for Pricing
View Details
ZNF706 (NM_001042510) Human Over-expression Lysate
LC420950 20 µg

ZNF706 (NM_001042510) Human Over-expression Lysate

Sign In for Pricing
View Details