Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycine max ATP synthase subunit a, chloroplastic (atpI)

This Recombinant Glycine max ATP synthase subunit a, chloroplastic (atpI) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

ATP synthase subunit a, chloroplastic, ATP synthase F0 sector subunit a, F-ATPase subunit IV

UniProt

Q2PMT1

Expression Region

1-247

Origin

Glycine max (Soybean) (Glycine hispida)

Field of Research

Metabolism Research; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVLLCSINTLKRLYDISAVEVGQHFYWQIGSFQVHAQVLITSWVVIALLLVSAILIIRN LQTIPAFGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTLFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSIAYFYAGLSKKGLAYFNKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARSA Antibody
KC-3856-01 50 μL

ARSA Antibody

Sign In for Pricing
View Details
ARSA Antibody
KC-3856-02 100 µL

ARSA Antibody

Sign In for Pricing
View Details
ARSA Antibody
KC-3856-03 1 mL

ARSA Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Cecum
CS803432 5x 5 µm

Tissue FFPE Sections, Cecum

Sign In for Pricing
View Details
C10orf99 Human Gene Knockout Kit (CRISPR)
KN424411 1 Kit

C10orf99 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Gliclazide
TRC-G409875-5G 5 g

Gliclazide

Sign In for Pricing
View Details