Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella boydii serotype 4 Cobalamin synthase (cobS)

This Recombinant Shigella boydii serotype 4 Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q322B3

Expression Region

1-247

Origin

Shigella boydii serotype 4 (strain Sb227)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLSFITRLPVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMVLQAWCG VPLAALFSVLVLALMTGGFHLDGLADTCDGVFSARSRDRMLEIMRDSRLGTHGGLALIFV VLAKILVLSELALRGEPILALLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQ TCVTLGLAAIFAAVLLPGMHGVAAMVVTMVAIFILGQLLKRTLGGQTGDTLGAAIELGEL VFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C12orf77 (NM_001101339) Human Recombinant Protein
TP761724 50 µg

C12orf77 (NM_001101339) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS711556 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF405S conjugate, 0.1mg/mL
BNC042984-100 1x 100 µL

Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTC1 Rabbit Polyclonal Antibody
TA370157 100 µL

ACTC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Propionaldehyde-2,2,3,3,3-d5
TRC-P782501-5MG 5 mg

Propionaldehyde-2,2,3,3,3-d5

Sign In for Pricing
View Details
Mouse Hcfc2 activation kit by CRISPRa
GA207596 1 Kit

Mouse Hcfc2 activation kit by CRISPRa

Sign In for Pricing
View Details